Lineage for d2pkxa1 (2pkx A:1-119)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (8 families) 
Family c.23.1.1: CheY-related [52173] (26 proteins) 
Protein PhoP receiver domain [82340] (2 species) 
Species Escherichia coli [TaxId:562] [159479] (4 PDB entries)
Uniprot P23836 1-119
Domain d2pkxa1: 2pkx A:1-119 [149606]
Details for d2pkxa1
PDB Entry: 2pkx (more details), 2.54 Å
PDB Description: e.coli response regulator phop receiver domain
PDB Compounds: (A:) Transcriptional regulatory protein phoPSCOPe Domain Sequences for d2pkxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pkxa1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]}
mrvlvvednallrhhlkvqiqdaghqvddaedakeadyylnehipdiaivdlglpdedgl
slirrwrsndvslpilvltareswqdkvevlsagaddyvtkpfhieevmarmqalmrrn
SCOPe Domain Coordinates for d2pkxa1:
Click to download the PDB-style file with coordinates for d2pkxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pkxa1:
- d2pkxa1 first appeared in SCOP 1.75
- d2pkxa1 appears in SCOPe 2.06
- d2pkxa1 appears in the current release, SCOPe 2.08
View in 3D
