Lineage for d2pkpa_ (2pkp A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434394Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2434442Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) (S)
    contains mixed beta-sheet barrel, closed n=7, S=10
  5. 2434484Family c.8.2.0: automated matches [191540] (1 protein)
    not a true family
  6. 2434485Protein automated matches [190925] (2 species)
    not a true protein
  7. 2434486Species Methanocaldococcus jannaschii [TaxId:243232] [188422] (2 PDB entries)
  8. 2434493Domain d2pkpa_: 2pkp A: [167207]
    automated match to d1v7la_
    complexed with peg, zn

Details for d2pkpa_

PDB Entry: 2pkp (more details), 2.1 Å

PDB Description: Crystal structure of 3-isopropylmalate dehydratase (leuD)from Methhanocaldococcus Jannaschii DSM2661 (MJ1271)
PDB Compounds: (A:) Homoaconitase small subunit

SCOPe Domain Sequences for d2pkpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pkpa_ c.8.2.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
miikgrahkfgddvdtdaiipgpylrttdpyelashcmagidenfpkkvkegdvivagen
fgcgssreqaviaikycgikaviaksfarifyrnainvglipiiantdeikdgdiveidl
dkeeivitnknktikcetpkglereilaagglvnylkkrkliqskkg

SCOPe Domain Coordinates for d2pkpa_:

Click to download the PDB-style file with coordinates for d2pkpa_.
(The format of our PDB-style files is described here.)

Timeline for d2pkpa_: