![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
![]() | Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) ![]() contains mixed beta-sheet barrel, closed n=7, S=10 |
![]() | Family c.8.2.0: automated matches [191540] (1 protein) not a true family |
![]() | Protein automated matches [190925] (2 species) not a true protein |
![]() | Species Methanocaldococcus jannaschii [TaxId:243232] [188422] (2 PDB entries) |
![]() | Domain d2pkpa_: 2pkp A: [167207] automated match to d1v7la_ complexed with peg, zn |
PDB Entry: 2pkp (more details), 2.1 Å
SCOPe Domain Sequences for d2pkpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pkpa_ c.8.2.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]} miikgrahkfgddvdtdaiipgpylrttdpyelashcmagidenfpkkvkegdvivagen fgcgssreqaviaikycgikaviaksfarifyrnainvglipiiantdeikdgdiveidl dkeeivitnknktikcetpkglereilaagglvnylkkrkliqskkg
Timeline for d2pkpa_: