SCOPe 2.05: Domain d2pk2a1: 2pk2 A:151-263

Lineage for d2pk2a1 (2pk2 A:151-263)

Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds)
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the others
Superfamily a.74.1: Cyclin-like [47954] (4 families)
duplication: consists of two domains of this fold
Family a.74.1.1: Cyclin [47955] (9 proteins)
Protein Cyclin T1 [158595] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150
Domain d2pk2a1: 2pk2 A:151-263 [149586]

Details for d2pk2a1

PDB Entry: 2pk2 (more details), 2.67 Å

PDB Description: cyclin box structure of the p-tefb subunit cyclin t1 derived from a fusion complex with eiav tat

PDB Compounds: (A:) Cyclin-T1, Protein Tat

SCOPe Domain Sequences for d2pk2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pk2a1 a.74.1.1 (A:151-263) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlkriwnwracea

SCOPe Domain Coordinates for d2pk2a1:

Click to download the PDB-style file with coordinates for d2pk2a1.
(The format of our PDB-style files is described here.)

Timeline for d2pk2a1: