Lineage for d2pjsa1 (2pjs A:3-113)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
duplication: consists of two clear structural repeats each having this fold
subunit fold and dimeric assembly are similar to those of glyoxalase
Protein Uncharacterized protein Atu1953 [160145] (1 species) Species Agrobacterium tumefaciens [TaxId:358] [160146] (1 PDB entry)
Uniprot Q8UE11 2-115
Domain d2pjsa1: 2pjs A:3-113 [149573]
segment-swapped dimer with an unusual middle-strand swap
complexed with zn
Details for d2pjsa1
PDB Entry: 2pjs (more details), 1.85 Å
PDB Description: Crystal structure of Atu1953, protein of unknown function
PDB Compounds: (A:) Uncharacterized protein Atu1953SCOPe Domain Sequences for d2pjsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]}
vrrvvaniatpeparaqafygdilgmpvamdhgwivthaspleahaqvsfareggsgtdv
pdlsievdnfdevharilkaglpieygpvteawgvqrlflrdpfgklinil
SCOPe Domain Coordinates for d2pjsa1:
Click to download the PDB-style file with coordinates for d2pjsa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pjsa1:
- d2pjsa1 first appeared in SCOP 1.75
- d2pjsa1 appears in SCOPe 2.07
View in 3D
