Lineage for d2piia_ (2pii A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. Species Escherichia coli [TaxId:562] [54916] (2 PDB entries)
  8. Domain d2piia_: 2pii A: [39071]

Details for d2piia_

PDB Entry: 2pii (more details), 1.9 Å

PDB Description: pii, glnb product
PDB Compounds: (A:) pii

SCOPe Domain Sequences for d2piia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2piia_ d.58.5.1 (A:) PII (product of glnB) {Escherichia coli [TaxId: 562]}
mkkidaiikpfklddvrealaevgitgmtvtevkgfgrqkghtelyrgaeymvdflpkvk
ieivvpddivdtcvdtiirtaqtgkigdgkifvfdvarvirirtgeeddaai

SCOPe Domain Coordinates for d2piia_ are not available.

Timeline for d2piia_: