Lineage for d2piha1 (2pih A:2-124)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2352057Fold a.281: YheA-like [158621] (1 superfamily)
    5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces
  4. 2352058Superfamily a.281.1: YheA/YmcA-like [158622] (2 families) (S)
  5. 2352059Family a.281.1.1: YmcA-like [158623] (1 protein)
    N-terminal and C-terminal parts correspond to PfamB PB012831 and PfamB PB007043, respectively
    automatically mapped to Pfam PF06133
  6. 2352060Protein Uncharacterized protein YmcA [158624] (2 species)
  7. 2352061Species Bacillus subtilis [TaxId:1423] [158625] (1 PDB entry)
    Uniprot O31779 2-124
  8. 2352062Domain d2piha1: 2pih A:2-124 [149511]

Details for d2piha1

PDB Entry: 2pih (more details), 2.1 Å

PDB Description: crystal structure of protein ymca from bacillus subtilis, northeast structural genomics target sr375
PDB Compounds: (A:) Protein ymcA

SCOPe Domain Sequences for d2piha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2piha1 a.281.1.1 (A:2-124) Uncharacterized protein YmcA {Bacillus subtilis [TaxId: 1423]}
tlyskkdivqqarnlakmiseteevdffkraeaqinendkvstivnqikalqkqavnlkh
yekhealkqveakidalqeeleeipviqefrdsqmevndllqlvahtisnqvtneiitst
ggd

SCOPe Domain Coordinates for d2piha1:

Click to download the PDB-style file with coordinates for d2piha1.
(The format of our PDB-style files is described here.)

Timeline for d2piha1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pihb_