SCOPe 2.05: Domain d2pgwb2: 2pgw B:132-375

Lineage for d2pgwb2 (2pgw B:132-375)

Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)

binds metal ion (magnesium or manganese) in conserved site inside barrel
N-terminal alpha+beta domain is common to this superfamily

Family c.1.11.0: automated matches [227196] (1 protein)
not a true family
Protein automated matches [226923] (71 species)
not a true protein
Species Sinorhizobium meliloti [TaxId:266834] [231148] (1 PDB entry)
Domain d2pgwb2: 2pgw B:132-375 [231149]
Other proteins in same PDB: d2pgwa1, d2pgwb1, d2pgwc1, d2pgwd1, d2pgwe1, d2pgwf1, d2pgwg1, d2pgwh1
automated match to d4mggf2
complexed with gol

Details for d2pgwb2

PDB Entry: 2pgw (more details), 1.95 Å

PDB Description: crystal structure of a putative muconate cycloisomerase from sinorhizobium meliloti 1021

PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d2pgwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pgwb2 c.1.11.0 (B:132-375) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
ahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaavrgeigda
rlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgipivadqaaf
tlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssfttgittcaeh
higlaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaedlvaegegr
yaas

SCOPe Domain Coordinates for d2pgwb2:

Click to download the PDB-style file with coordinates for d2pgwb2.
(The format of our PDB-style files is described here.)

Timeline for d2pgwb2: