| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.23: Marine metagenome family DABB3 [160306] (1 protein) duplication: consists of two similar domains; forms a pentamer similar to the Chlorite dismutase-like pentamer and the MLI decamer |
| Protein Uncharacterized protein GOS_2596953 [160307] (1 species) |
| Species Environmental samples [TaxId:33858] [160308] (1 PDB entry) |
| Domain d2pgca1: 2pgc A:1-206 [149457] complexed with cl |
PDB Entry: 2pgc (more details), 2.53 Å
SCOPe Domain Sequences for d2pgca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pgca1 d.58.4.23 (A:1-206) Uncharacterized protein GOS_2596953 {Environmental samples [TaxId: 33858]}
msninyviltvasvdfsyretmarlmssyskdlidnagakgtrfgsigtgdhagslifiq
fyddltgyqkaleiqskssvfkeimdsgkaniylrnistslptkfeqsyehpkyivltra
eaamsdkdkflncindtascfkdngaltlrfgnlltgsnvgnyllgvgypsmeaiektyd
ellahssykelmtfakvnmrniikil
Timeline for d2pgca1:
View in 3DDomains from other chains: (mouse over for more information) d2pgcb_, d2pgcc_, d2pgcd_, d2pgce_ |