Lineage for d2pfxa1 (2pfx A:1-190)
- Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds) 
Fold a.152: AhpD-like [69117] (1 superfamily)
multihelical; contains 4-helical bundle and 2-helical armSuperfamily a.152.1: AhpD-like [69118] (4 families) 
probable biological unit contains six domains of this fold arranged with 32 symmetry
Family a.152.1.3: Atu0492-like [140970] (6 proteins)
duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
Protein Uncharacterized protein TM1040_2465 [158823] (1 species) Species Silicibacter sp. tm1040 [TaxId:292414] [158824] (1 PDB entry)
Uniprot Q1GDR9 1-190
Domain d2pfxa1: 2pfx A:1-190 [149452]
complexed with act, cl, pg4
Details for d2pfxa1
PDB Entry: 2pfx (more details), 1.7 Å
PDB Description: crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution
PDB Compounds: (A:) Uncharacterized peroxidase-related proteinSCOPe Domain Sequences for d2pfxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pfxa1 a.152.1.3 (A:1-190) Uncharacterized protein TM1040_2465 {Silicibacter sp. tm1040 [TaxId: 292414]}
mtkpkeptaldlpmadplpdetqkyfeicqeklgmvpnvlkayafnveklnaftamyndl
mlgesqlskleremiavvvssinkcfyclvahgaavrqlsgdpqlgemlvmnyrvaplda
rqrvmldfaakmtrasaeieeadrevlrshgfndrdiwdianvtgffnmtnrvasatamm
pnaeyhgqfr
SCOPe Domain Coordinates for d2pfxa1:
Click to download the PDB-style file with coordinates for d2pfxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pfxa1:
- d2pfxa1 first appeared in SCOP 1.75
- d2pfxa1 appears in SCOPe 2.02
- d2pfxa1 appears in the current release, SCOPe 2.08
View in 3D
