Lineage for d2pcda_ (2pcd A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379685Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2379686Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2379709Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 2379717Species Pseudomonas putida [TaxId:303] [49487] (36 PDB entries)
  8. 2379874Domain d2pcda_: 2pcd A: [22665]
    Other proteins in same PDB: d2pcdm_, d2pcdn_, d2pcdo_, d2pcdp_, d2pcdq_, d2pcdr_
    complexed with fe

Details for d2pcda_

PDB Entry: 2pcd (more details), 2.15 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase from pseudomonas aeruginosa at 2.15 angstroms resolution
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase (alpha chain)

SCOPe Domain Sequences for d2pcda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcda_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d2pcda_:

Click to download the PDB-style file with coordinates for d2pcda_.
(The format of our PDB-style files is described here.)

Timeline for d2pcda_: