Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein) Pfam PF06849; DUF1246 |
Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species) |
Species Thermococcus kodakaraensis [TaxId:311400] [159529] (1 PDB entry) Uniprot Q5JD28 2-97 |
Domain d2pbza1: 2pbz A:4-99 [149371] Other proteins in same PDB: d2pbza2, d2pbzb2, d2pbzc2 complexed with atp |
PDB Entry: 2pbz (more details), 2.5 Å
SCOPe Domain Sequences for d2pbza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pbza1 c.30.1.8 (A:4-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]} ivstiashsslqillgakkegfktrlyvspkrrpfysslpivddlvvaeemtsilnddgi vvphgsfvaylgieaiekakarffgnrrflkwettf
Timeline for d2pbza1:
View in 3D Domains from other chains: (mouse over for more information) d2pbzb1, d2pbzb2, d2pbzc1, d2pbzc2 |