Lineage for d2p9ha1 (2p9h A:62-330)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185128Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1185129Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1185130Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1185232Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 1185233Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)
  8. 1185235Domain d2p9ha1: 2p9h A:62-330 [139580]
    automatically matched to d1jyea_
    complexed with ipt

Details for d2p9ha1

PDB Entry: 2p9h (more details), 2 Å

PDB Description: high resolution structure of the lactose repressor bound to iptg
PDB Compounds: (A:) lactose operon repressor

SCOPe Domain Sequences for d2p9ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9ha1 c.93.1.1 (A:62-330) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttl

SCOPe Domain Coordinates for d2p9ha1:

Click to download the PDB-style file with coordinates for d2p9ha1.
(The format of our PDB-style files is described here.)

Timeline for d2p9ha1: