![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.12: Ava3068-like [160858] (1 protein) |
![]() | Protein Hypothetical protein Ava3068 [160859] (1 species) |
![]() | Species Anabaena variabilis [TaxId:1172] [160860] (1 PDB entry) Uniprot Q3M8K9 1-200 |
![]() | Domain d2p97a1: 2p97 A:1-200 [149328] Other proteins in same PDB: d2p97a2, d2p97b3 complexed with cl, mg |
PDB Entry: 2p97 (more details), 1.65 Å
SCOPe Domain Sequences for d2p97a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} mkslhrpdlyswstfnparnidfngfawirpegnilidpvalsnhdwkhleslggvvwiv ltnsdhvrsakeiadqtytkiagpvaekenfpiycdrwlsdgdelvpglkvmelqgsktp gelallleettlitgdlvrayraggleilpdeklmnkqkvvasvrrlaalekveavlvgd gwsvfrdgrdrlkelvatla
Timeline for d2p97a1: