Lineage for d2p8ga_ (2p8g A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1800644Family b.60.1.6: Phenolic acid decarboxylase (PAD) [141469] (2 proteins)
    Pfam PF05870; dimeric enzyme made of lipocalin-like subunits
  6. 1800651Protein automated matches [226940] (3 species)
    not a true protein
  7. 1800655Species Bacillus subtilis [TaxId:1423] [225256] (2 PDB entries)
  8. 1800656Domain d2p8ga_: 2p8g A: [205481]
    automated match to d2wsja_
    complexed with edo

Details for d2p8ga_

PDB Entry: 2p8g (more details), 1.36 Å

PDB Description: crystal structure of phenolic acid decarboxylase (2635953) from bacillus subtilis at 1.36 a resolution
PDB Compounds: (A:) Phenolic acid decarboxylase

SCOPe Domain Sequences for d2p8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8ga_ b.60.1.6 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
gmenfigshmiytyengweyeiyikndhtidyrihsgmvagrwvrdqevnivkltegvyk
vswteptgtdvslnfmpnekrmhgiiffpkwvhehpeitvcyqndhidlmkesrekyety
pkyvvpefaeitflknegvdneevisyapyegmtddiragrl

SCOPe Domain Coordinates for d2p8ga_:

Click to download the PDB-style file with coordinates for d2p8ga_.
(The format of our PDB-style files is described here.)

Timeline for d2p8ga_: