Lineage for d2p6ra2 (2p6r A:489-686)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739248Fold a.289: Sec63 N-terminal domain-like [158701] (1 superfamily)
    multihelical; consists of two helical subdomains
  4. 2739249Superfamily a.289.1: Sec63 N-terminal domain-like [158702] (4 families) (S)
  5. 2739254Family a.289.1.2: Achaeal helicase C-terminal domain [158706] (1 protein)
  6. 2739255Protein Hel308 helicase [158707] (1 species)
  7. 2739256Species Archaeoglobus fulgidus [TaxId:2234] [158708] (1 PDB entry)
  8. 2739257Domain d2p6ra2: 2p6r A:489-686 [149271]
    Other proteins in same PDB: d2p6ra1, d2p6ra3, d2p6ra4
    protein/DNA complex

Details for d2p6ra2

PDB Entry: 2p6r (more details), 3 Å

PDB Description: Crystal structure of superfamily 2 helicase Hel308 in complex with unwound DNA
PDB Compounds: (A:) afUHEL308 HELICASE

SCOPe Domain Sequences for d2p6ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p6ra2 a.289.1.2 (A:489-686) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}
dpltgfifhdvlsrmelsdigalhlicrtpdmerltvrktdswveeeafrlrkelsyyps
dfsveydwflsevktalclkdwieekdedeicakygiapgdlrrivetaewlsnamnria
eevgntsvsglterikhgvkeellelvrirhigrvrarklynagirnaedivrhrekvas
ligrgiaervvegisvks

SCOPe Domain Coordinates for d2p6ra2:

Click to download the PDB-style file with coordinates for d2p6ra2.
(The format of our PDB-style files is described here.)

Timeline for d2p6ra2: