Lineage for d2p6ra1 (2p6r A:404-488)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694109Family a.4.5.43: RecQ helicase DNA-binding domain-like [101030] (3 proteins)
    follows the tandem AAA-ATPase domain
  6. 2694114Protein Hel308 helicase [158286] (1 species)
  7. 2694115Species Archaeoglobus fulgidus [TaxId:2234] [158287] (1 PDB entry)
  8. 2694116Domain d2p6ra1: 2p6r A:404-488 [149270]
    Other proteins in same PDB: d2p6ra2, d2p6ra3, d2p6ra4
    protein/DNA complex

Details for d2p6ra1

PDB Entry: 2p6r (more details), 3 Å

PDB Description: Crystal structure of superfamily 2 helicase Hel308 in complex with unwound DNA
PDB Compounds: (A:) afUHEL308 HELICASE

SCOPe Domain Sequences for d2p6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}
ritsklgvethlrfhslsiicdgyaktleeledffadtfffkqneislsyelervvrqle
nwgmvveaahlaptklgslvsrlyi

SCOPe Domain Coordinates for d2p6ra1:

Click to download the PDB-style file with coordinates for d2p6ra1.
(The format of our PDB-style files is described here.)

Timeline for d2p6ra1: