Lineage for d2p62a1 (2p62 A:1-241)
- Root: SCOPe 2.08
Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) 
Fold e.67: PH0156-like [160944] (1 superfamily)
2 (sub)domains; d1: [alpha/beta with central mixed beta-sheet, order: 23415876, similarity to the G protein but no P-loop]; d2: [all-alpha, 5 helices, provides dimerization interface]Superfamily e.67.1: PH0156-like [160945] (1 family) 
automatically mapped to Pfam PF11536Family e.67.1.1: PH0156-like [160946] (1 protein)
PfamB PB117416Protein Hypothetical protein PH0156 [160947] (1 species) Species Pyrococcus horikoshii [TaxId:53953] [160948] (1 PDB entry)
Uniprot O57895 1-241
Domain d2p62a1: 2p62 A:1-241 [149267]
Details for d2p62a1
PDB Entry: 2p62 (more details), 2.5 Å
PDB Description: crystal structure of hypothetical protein ph0156 from pyrococcus horikoshii ot3
PDB Compounds: (A:) Hypothetical protein PH0156SCOPe Domain Sequences for d2p62a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p62a1 e.67.1.1 (A:1-241) Hypothetical protein PH0156 {Pyrococcus horikoshii [TaxId: 53953]}
mrikliivegktdesffkvlleklygfreakkltpefpigkwgfrigehplvlekdnial
viihaegkqripkvlksvldsvklgllnveevyvvrdvdegndvfewvlsflrerevrvd
ngaivtegvkiypygmgnltlnepfvkekkelelslaylakldgilekyrgsmralsqdk
gdkltpkdvmhilsiandytgdclsglyekyigimihrnrellirflsevnllpllermv
g
SCOPe Domain Coordinates for d2p62a1:
Click to download the PDB-style file with coordinates for d2p62a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p62a1:
- d2p62a1 first appeared in SCOP 1.75
- d2p62a1 appears in SCOPe 2.07
View in 3D
