SCOPe 2.06: Domain d2p5vb2: 2p5v B:66-158

Lineage for d2p5vb2 (2p5v B:66-158)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.0: automated matches [191316] (1 protein)
not a true family
Protein automated matches [190081] (27 species)
not a true protein
Species Neisseria meningitidis [TaxId:122586] [231120] (3 PDB entries)
Domain d2p5vb2: 2p5v B:66-158 [231121]
Other proteins in same PDB: d2p5va1, d2p5vb1, d2p5vc1, d2p5vd1, d2p5ve1, d2p5vf1, d2p5vg1, d2p5vh1
automated match to d2cyya2
complexed with ca, cl, gol

Details for d2p5vb2

PDB Entry: 2p5v (more details), 1.99 Å

PDB Description: Crystal Structure of Transcriptional Regulator NMB0573 from Neisseria Meningitidis

PDB Compounds: (B:) Transcriptional regulator, LRP/AsnC family

SCOPe Domain Sequences for d2p5vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5vb2 d.58.4.0 (B:66-158) automated matches {Neisseria meningitidis [TaxId: 122586]}
lglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfvl
dtllshhgvqdaqssfvlkeikhttslplnhll

SCOPe Domain Coordinates for d2p5vb2:

Click to download the PDB-style file with coordinates for d2p5vb2.
(The format of our PDB-style files is described here.)

Timeline for d2p5vb2: