Lineage for d2p4ka2 (2p4k A:84-198)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) 
automatically mapped to Pfam PF02777Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) 
Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries) 
Domain d2p4ka2: 2p4k A:84-198 [139488]
Other proteins in same PDB: d2p4ka1, d2p4kb1, d2p4kc1, d2p4kd1
automated match to d2p4ka2
complexed with mn
Details for d2p4ka2
PDB Entry: 2p4k (more details), 1.48 Å
PDB Description: contribution to structure and catalysis of tyrosine 34 in human manganese superoxide dismutase
PDB Compounds: (A:) superoxide dismutaseSCOPe Domain Sequences for d2p4ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4ka2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk
SCOPe Domain Coordinates for d2p4ka2:
Click to download the PDB-style file with coordinates for d2p4ka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p4ka2:
- d2p4ka2 first appeared in SCOP 1.73
- d2p4ka2 appears in SCOPe 2.07
View in 3D
