Lineage for d2p42b1 (2p42 B:1-121)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781558Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species)
  7. 781559Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (22 PDB entries)
    SQ NA # camelid antibody
  8. 781574Domain d2p42b1: 2p42 B:1-121 [149195]
    Other proteins in same PDB: d2p42a1, d2p42c1
    automatically matched to d1bzqk_
    complexed with mg

Details for d2p42b1

PDB Entry: 2p42 (more details), 1.8 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.8A resolution: SE3-mono-2 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold
PDB Compounds: (B:) antibody cab-rn05

SCOP Domain Sequences for d2p42b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p42b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
s

SCOP Domain Coordinates for d2p42b1:

Click to download the PDB-style file with coordinates for d2p42b1.
(The format of our PDB-style files is described here.)

Timeline for d2p42b1: