Class b: All beta proteins [48724] (174 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins) this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain |
Protein automated matches [190704] (4 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [187975] (1 PDB entry) |
Domain d2p2oa_: 2p2o A: [166965] automated match to d1ocxa_ |
PDB Entry: 2p2o (more details), 1.74 Å
SCOPe Domain Sequences for d2p2oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p2oa_ b.81.1.3 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} ksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstgerl fiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldpher nsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakvi kwlk
Timeline for d2p2oa_: