Lineage for d2p2ib_ (2p2i B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983234Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2983235Species Human (Homo sapiens) [TaxId:9606] [56161] (30 PDB entries)
  8. 2983260Domain d2p2ib_: 2p2i B: [139464]
    Other proteins in same PDB: d2p2ia3
    automated match to d1vr2a_
    complexed with 608

Details for d2p2ib_

PDB Entry: 2p2i (more details), 2.4 Å

PDB Description: crystal structure of the vegfr2 kinase domain in complex with a nicotinamide inhibitor
PDB Compounds: (B:) Vascular endothelial growth factor receptor 2

SCOPe Domain Sequences for d2p2ib_:

Sequence, based on SEQRES records: (download)

>d2p2ib_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
ralmselkilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpyk
vapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgl
ardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgv
kideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqana

Sequence, based on observed residues (ATOM records): (download)

>d2p2ib_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgqvieadafgidktatcrtvavkmlthsehralmsel
kilihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpykfltlehl
icysfqvakgmeflasrkcihrdlaarnillseknvvkicdfplkwmapetifdrvytiq
sdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhg
epsqrptfselvehlgnllqana

SCOPe Domain Coordinates for d2p2ib_:

Click to download the PDB-style file with coordinates for d2p2ib_.
(The format of our PDB-style files is described here.)

Timeline for d2p2ib_: