| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
| Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein) |
| Protein S-adenosylmethionine synthetase [55975] (3 species) synonym: methionine adenosyltransferase, MAT |
| Species Human (Homo sapiens), isoform type-2 [TaxId:9606] [160759] (2 PDB entries) Uniprot P31153 126-251! Uniprot P31153 16-125! Uniprot P31153 252-395 MAT2A |
| Domain d2p02a2: 2p02 A:148-273 [149133] complexed with cl, sam |
PDB Entry: 2p02 (more details), 1.21 Å
SCOPe Domain Sequences for d2p02a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p02a2 d.130.1.1 (A:148-273) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]}
needigagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvt
vqymqdrgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlq
psgrfv
Timeline for d2p02a2: