Lineage for d2ozza1 (2ozz A:1-228)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) 
Protein Hypothetical protein YhfZ [159812] (1 species) Species Shigella flexneri [TaxId:623] [159813] (1 PDB entry)
Uniprot Q83JA6 1-228
Domain d2ozza1: 2ozz A:1-228 [149131]
complexed with so4
Details for d2ozza1
PDB Entry: 2ozz (more details), 2.3 Å
PDB Description: crystal structure of yhfz from shigella flexneri
PDB Compounds: (A:) Hypothetical protein yhfZSCOPe Domain Sequences for d2ozza1:
Sequence, based on SEQRES records: (download)
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}
mdnkallshvdinnvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirveclln
gvydmavvsrlaaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsrsad
qkimtdvffgdsdvervdlsyheslqrivkgdvdaviwnvvaeneltmlgleatpltddp
rflqateavvltrvddypmqqllravvdkhallahqqrvvsgeqepsy
Sequence, based on observed residues (ATOM records): (download)
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}
mdnkallshvdinnvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirveclln
gvydmavvsrlaaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsrsad
qkimtdvffgdsdvervdlsyheslqrivkgdvdaviwnvaeneltmlgleatpltddpr
flqateavvltrvddypmqqllravvdkhallahqqrvvsgeqepsy
SCOPe Domain Coordinates for d2ozza1:
Click to download the PDB-style file with coordinates for d2ozza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ozza1:
- d2ozza1 first appeared in SCOP 1.75
- d2ozza1 appears in SCOPe 2.02
- d2ozza1 appears in the current release, SCOPe 2.08
View in 3D
