Lineage for d2ozza1 (2ozz A:1-228)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009087Protein Hypothetical protein YhfZ [159812] (1 species)
  7. 1009088Species Shigella flexneri [TaxId:623] [159813] (1 PDB entry)
    Uniprot Q83JA6 1-228
  8. 1009089Domain d2ozza1: 2ozz A:1-228 [149131]
    complexed with so4

Details for d2ozza1

PDB Entry: 2ozz (more details), 2.3 Å

PDB Description: crystal structure of yhfz from shigella flexneri
PDB Compounds: (A:) Hypothetical protein yhfZ

SCOPe Domain Sequences for d2ozza1:

Sequence, based on SEQRES records: (download)

>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}
mdnkallshvdinnvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirveclln
gvydmavvsrlaaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsrsad
qkimtdvffgdsdvervdlsyheslqrivkgdvdaviwnvvaeneltmlgleatpltddp
rflqateavvltrvddypmqqllravvdkhallahqqrvvsgeqepsy

Sequence, based on observed residues (ATOM records): (download)

>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}
mdnkallshvdinnvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirveclln
gvydmavvsrlaaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsrsad
qkimtdvffgdsdvervdlsyheslqrivkgdvdaviwnvaeneltmlgleatpltddpr
flqateavvltrvddypmqqllravvdkhallahqqrvvsgeqepsy

SCOPe Domain Coordinates for d2ozza1:

Click to download the PDB-style file with coordinates for d2ozza1.
(The format of our PDB-style files is described here.)

Timeline for d2ozza1: