Lineage for d2oz6a1 (2oz6 A:143-213)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins) 
Protein Cyclic AMP receptor-like protein Vfr [158266] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [158267] (1 PDB entry)
Uniprot P55222 143-213
Domain d2oz6a1: 2oz6 A:143-213 [149103]
Other proteins in same PDB: d2oz6a2
protein/DNA complex; complexed with cmp
Details for d2oz6a1
PDB Entry: 2oz6 (more details), 2.8 Å
PDB Description: crystal structure of virulence factor regulator from pseudomonas aeruginosa in complex with camp
PDB Compounds: (A:) Virulence Factor RegulatorSCOPe Domain Sequences for d2oz6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oz6a1 a.4.5.4 (A:143-213) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]}
dvtgrvartlldlcqqpdamthpdgmqikitrqeigrivgcsremvgrvlksleeqglvh
vkgktmvvfgt
SCOPe Domain Coordinates for d2oz6a1:
Click to download the PDB-style file with coordinates for d2oz6a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2oz6a1:
- d2oz6a1 first appeared in SCOP 1.75
- d2oz6a1 appears in SCOPe 2.07
View in 3D
