Class a: All alpha proteins [46456] (290 folds) |
Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
Superfamily a.152.1: AhpD-like [69118] (4 families) probable biological unit contains six domains of this fold arranged with 32 symmetry |
Family a.152.1.3: Atu0492-like [140970] (6 proteins) duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family |
Protein Uncharacterized protein Dgeo_1446 [158821] (1 species) |
Species Deinococcus geothermalis [TaxId:68909] [158822] (1 PDB entry) Uniprot Q1IYE3 10-195 |
Domain d2oyoa1: 2oyo A:10-195 [149068] complexed with mpd |
PDB Entry: 2oyo (more details), 1.51 Å
SCOPe Domain Sequences for d2oyoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oyoa1 a.152.1.3 (A:10-195) Uncharacterized protein Dgeo_1446 {Deinococcus geothermalis [TaxId: 68909]} drisslpvpdatqvpegvrklwakaeanigfvpnvfraqavngeqflawwnyfnlllnke gyltnaerelvavvvsgvnrclycavshgaalreflgdpqkadavavnwrhadltereqa laayaekltrhpaevtaadleplravglddhqimelvqvigmfnltnrvssalgfvpnpe yyrqar
Timeline for d2oyoa1: