Lineage for d2oyoa1 (2oyo A:10-195)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.152: AhpD-like [69117] (1 superfamily)
multihelical; contains 4-helical bundle and 2-helical armSuperfamily a.152.1: AhpD-like [69118] (4 families) 
probable biological unit contains six domains of this fold arranged with 32 symmetry
Family a.152.1.3: Atu0492-like [140970] (6 proteins)
duplication: similar subunit structure to the AhpD family, but the putative active site is conserved in different relative location; new hexameric architecture; similar dimeric interface to the CMD-like family
Protein Uncharacterized protein Dgeo_1446 [158821] (1 species) Species Deinococcus geothermalis [TaxId:68909] [158822] (1 PDB entry)
Uniprot Q1IYE3 10-195
Domain d2oyoa1: 2oyo A:10-195 [149068]
complexed with mpd
Details for d2oyoa1
PDB Entry: 2oyo (more details), 1.51 Å
PDB Description: crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution
PDB Compounds: (A:) Uncharacterized peroxidase-related proteinSCOPe Domain Sequences for d2oyoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oyoa1 a.152.1.3 (A:10-195) Uncharacterized protein Dgeo_1446 {Deinococcus geothermalis [TaxId: 68909]}
drisslpvpdatqvpegvrklwakaeanigfvpnvfraqavngeqflawwnyfnlllnke
gyltnaerelvavvvsgvnrclycavshgaalreflgdpqkadavavnwrhadltereqa
laayaekltrhpaevtaadleplravglddhqimelvqvigmfnltnrvssalgfvpnpe
yyrqar
SCOPe Domain Coordinates for d2oyoa1:
Click to download the PDB-style file with coordinates for d2oyoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2oyoa1:
- d2oyoa1 first appeared in SCOP 1.75
- d2oyoa1 appears in SCOPe 2.07
View in 3D
