Lineage for d2oxea2 (2oxe A:356-469)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
sandwich; 8 strands in 2 sheets; complex topology
duplication: has weak internal pseudo twofold symmetrySuperfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) 
Family b.12.1.0: automated matches [227174] (1 protein)
not a true familyProtein automated matches [226891] (5 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [225245] (9 PDB entries) 
Domain d2oxea2: 2oxe A:356-469 [205397]
Other proteins in same PDB: d2oxea1, d2oxeb1
automated match to d1bu8a1
complexed with ca, cl
Details for d2oxea2
PDB Entry: 2oxe (more details), 2.8 Å
PDB Description: structure of the human pancreatic lipase-related protein 2
PDB Compounds: (A:) Pancreatic lipase-related protein 2SCOPe Domain Sequences for d2oxea2:
Sequence, based on SEQRES records: (download)
>d2oxea2 b.12.1.0 (A:356-469) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swrykvsvtlsgkekvngyirialygsnenskqyeifkgslkpdashtcaidvdfnvgki
qkvkflwnkrginlsepklgasqitvqsgedgteynfcssdtveenvlqslypc
Sequence, based on observed residues (ATOM records): (download)
>d2oxea2 b.12.1.0 (A:356-469) automated matches {Human (Homo sapiens) [TaxId: 9606]}
swrykvsvtlsgkekvngyirialygsnenskqyeifkgslkpdashtcaidvdfnvgki
qkvkflwnkepklgasqitvqsgedgteynfcssdtveenvlqslypc
SCOPe Domain Coordinates for d2oxea2:
Click to download the PDB-style file with coordinates for d2oxea2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2oxea2:
- d2oxea2 first appeared in SCOPe 2.03
- d2oxea2 appears in SCOPe 2.06
- d2oxea2 appears in the current release, SCOPe 2.08
View in 3D
