Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (8 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (13 PDB entries) |
Domain d2ox9b_: 2ox9 B: [166897] automated match to d1t8ca1 complexed with ca |
PDB Entry: 2ox9 (more details), 1.95 Å
SCOPe Domain Sequences for d2ox9b_:
Sequence, based on SEQRES records: (download)
>d2ox9b_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} cpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgreshwi gltdseqesewkwldgspvdyknwkagqpdnwgsghgpgedcagliyagqwndfqcdein nficekereavp
>d2ox9b_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} cpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgreshwi gltdseqesewkwldgspvdyknwkagqpdnwpgedcagliyagqwndfqcdeinnfice kereavp
Timeline for d2ox9b_: