Lineage for d2ox9b_ (2ox9 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443240Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1443241Protein automated matches [190159] (8 species)
    not a true protein
  7. 1443457Species Mouse (Mus musculus) [TaxId:10090] [187331] (13 PDB entries)
  8. 1443467Domain d2ox9b_: 2ox9 B: [166897]
    automated match to d1t8ca1
    complexed with ca

Details for d2ox9b_

PDB Entry: 2ox9 (more details), 1.95 Å

PDB Description: mouse scavenger receptor c-type lectin carbohydrate-recognition domain.
PDB Compounds: (B:) Collectin placenta 1

SCOPe Domain Sequences for d2ox9b_:

Sequence, based on SEQRES records: (download)

>d2ox9b_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgreshwi
gltdseqesewkwldgspvdyknwkagqpdnwgsghgpgedcagliyagqwndfqcdein
nficekereavp

Sequence, based on observed residues (ATOM records): (download)

>d2ox9b_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
cpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgreshwi
gltdseqesewkwldgspvdyknwkagqpdnwpgedcagliyagqwndfqcdeinnfice
kereavp

SCOPe Domain Coordinates for d2ox9b_:

Click to download the PDB-style file with coordinates for d2ox9b_.
(The format of our PDB-style files is described here.)

Timeline for d2ox9b_: