Lineage for d2ov9a1 (2ov9 A:7-209)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943891Protein Hypothetical protein RHA1_ro05818 [160184] (1 species)
    includes two extra N-terminal helices forming an interlocking four-helical bundle in the dimer
  7. 2943892Species Rhodococcus sp. RHA1 [TaxId:101510] [160185] (1 PDB entry)
    Uniprot Q0S4E1 7-209
  8. 2943893Domain d2ov9a1: 2ov9 A:7-209 [149034]
    complexed with so4

Details for d2ov9a1

PDB Entry: 2ov9 (more details), 1.9 Å

PDB Description: Crystal structure of protein RHA08564, thioesterase superfamily protein
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ov9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ov9a1 d.38.1.5 (A:7-209) Hypothetical protein RHA1_ro05818 {Rhodococcus sp. RHA1 [TaxId: 101510]}
ptfenspsgtvltsppdgsavdratdaarrvvdallrtdrgnanlervaeelnsiaghle
ehapavaerlidmwngegvtrhdpvtgpenalappvvleglsdgsvrgtvtltipyqgpp
ghvhggvsallldhvlgvanawggkagmtaqlstryhrptplfepltltgklmsvdgrki
ttagdirtadgqvcvsveglfvd

SCOPe Domain Coordinates for d2ov9a1:

Click to download the PDB-style file with coordinates for d2ov9a1.
(The format of our PDB-style files is described here.)

Timeline for d2ov9a1: