Lineage for d2ouwa1 (2ouw A:1-134)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735103Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2735104Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2735230Family a.152.1.4: TTHA0727-like [140975] (2 proteins)
    similar to the CMD-like family by the subunit sequence and hexameric architecture; the segment-swapped subunit fold is similar to the AhpD domains
  6. 2735231Protein Hypothetical protein Rru_A0301 [158827] (1 species)
  7. 2735232Species Rhodospirillum rubrum [TaxId:1085] [158828] (1 PDB entry)
    Uniprot Q2RXN9 1-134
  8. 2735233Domain d2ouwa1: 2ouw A:1-134 [149029]
    Other proteins in same PDB: d2ouwa2, d2ouwb3
    complexed with acy, na, unl

Details for d2ouwa1

PDB Entry: 2ouw (more details), 1.95 Å

PDB Description: crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution
PDB Compounds: (A:) Alkylhydroperoxidase AhpD core

SCOPe Domain Sequences for d2ouwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ouwa1 a.152.1.4 (A:1-134) Hypothetical protein Rru_A0301 {Rhodospirillum rubrum [TaxId: 1085]}
matvrllddaeistlpevkavfddiratrgsdfvnniwrglandpallkrtweqvktvmv
gegaldpltremiylavstanscsycahshtaaarakgmtpaqhaevlaiiglaaqtnal
vtamqipvdeaflv

SCOPe Domain Coordinates for d2ouwa1:

Click to download the PDB-style file with coordinates for d2ouwa1.
(The format of our PDB-style files is described here.)

Timeline for d2ouwa1:

2735233
d2ouwa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2ouwa2