Lineage for d2ouva_ (2ouv A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) 
Family a.211.1.0: automated matches [191566] (1 protein)
not a true familyProtein automated matches [190983] (6 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries) 
Domain d2ouva_: 2ouv A: [231109]
automated match to d3wi2a_
complexed with mg, zn; mutant
Details for d2ouva_
PDB Entry: 2ouv (more details), 1.56 Å
PDB Description: crystal structure of pde10a2 mutant of d564n
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10ASCOPe Domain Sequences for d2ouva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ouva_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfele
klcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchnld
hrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleii
rkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtk
ltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilp
ptepllkacrdnlsqwekvirgeet
SCOPe Domain Coordinates for d2ouva_:
Click to download the PDB-style file with coordinates for d2ouva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ouva_:
- d2ouva_ first appeared in SCOPe 2.03
- d2ouva_ appears in SCOPe 2.04
- d2ouva_ is called d2ouva1 in SCOPe 2.06
- d2ouva_ appears in the current release, SCOPe 2.08, called d2ouva1
View in 3D
