Lineage for d2oula_ (2oul A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily)
consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-AsnSuperfamily d.3.1: Cysteine proteinases [54001] (24 families) 
the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
Family d.3.1.1: Papain-like [54002] (26 proteins) 
Protein Falcipain 2 [142846] (1 species) Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [142847] (5 PDB entries)
Uniprot Q9N6S8 244-484
Domain d2oula_: 2oul A: [149025]
Other proteins in same PDB: d2oulb_
automated match to d1yvba1
Details for d2oula_
PDB Entry: 2oul (more details), 2.2 Å
PDB Description: the structure of chagasin in complex with a cysteine protease clarifies the binding mode and evolution of a new inhibitor family
PDB Compounds: (A:) falcipain 2SCOPe Domain Sequences for d2oula_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oula_ d.3.1.1 (A:) Falcipain 2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
e
SCOPe Domain Coordinates for d2oula_:
Click to download the PDB-style file with coordinates for d2oula_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2oula_:
- d2oula_ first appeared in SCOP 1.75, called d2oula1
- d2oula_ appears in SCOPe 2.06
- d2oula_ appears in the current release, SCOPe 2.08
View in 3D
