Lineage for d2orta_ (2ort A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1683350Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 1683351Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 1683352Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 1683353Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 1683559Species Mouse (Mus musculus) [TaxId:10090] [56515] (43 PDB entries)
    Uniprot P29477 77-496 ! Uniprot P29477 77-495
  8. 1683560Domain d2orta_: 2ort A: [166835]
    automated match to d1nosa_
    complexed with 342, hem

Details for d2orta_

PDB Entry: 2ort (more details), 1.87 Å

PDB Description: Murine Inducible Nitric Oxide Synthase Oxygenase Domain (Delta 114) 1-Benzo[1,3]dioxol-5-ylmethyl-3S-(4-imidazol-1-yl-phenoxy)-piperidine Complex
PDB Compounds: (A:) Nitric oxide synthase, inducible

SCOPe Domain Sequences for d2orta_:

Sequence, based on SEQRES records: (download)

>d2orta_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
mnpksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgty
qltldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngn
irsaitvfpqrsdgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkpry
grfdvlplvlqadgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllev
gglefpacpfngwymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravtein
vavlhsfqkqnvtimdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqe
mlnyvlspfyyyqiepwkthiwqne

Sequence, based on observed residues (ATOM records): (download)

>d2orta_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]}
mnpksltrgprdkptpleellphaiefinqyygsfkeakieehlarleavtkeiettgty
qltldelifatkmawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngn
irsaitvfpqrsdgkhdfrlwnsqliryagytirgdaatleftqlcidlgwkprygrfdv
lplvlqadgqdpevfeippdlvlevtmewelglkwyalpavanmllevgglefpacpfng
wymgnvavlhsfqkqnvtimdhhtasesfmkhmqneyvlspfyyyqiepwkthiwqne

SCOPe Domain Coordinates for d2orta_:

Click to download the PDB-style file with coordinates for d2orta_.
(The format of our PDB-style files is described here.)

Timeline for d2orta_: