| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
| Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins) automatically mapped to Pfam PF02126 |
| Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species) |
| Species Pseudomonas diminuta [TaxId:293] [51566] (41 PDB entries) Uniprot P0A434 30-365 |
| Domain d2oqlb_: 2oql B: [166827] automated match to d1hzya_ complexed with btb, gol, zn; mutant |
PDB Entry: 2oql (more details), 1.8 Å
SCOPe Domain Sequences for d2oqlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oqlb_ c.1.9.3 (B:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldqipfsaiglednasasallgi
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflsptlra
Timeline for d2oqlb_: