Lineage for d2onda1 (2ond A:242-549)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.8: TPR-like [48452] (11 families) 
Family a.118.8.7: HAT/Suf repeat [158782] (4 proteins)
includes Pfam PF05843
Pfam PF02184
this is a repeat family; one repeat unit is 2ond A:372-408 found in domainProtein Cleavage stimulation factor 77 kDa subunit CSTF3 [158783] (2 species) Species Mouse (Mus musculus) [TaxId:10090] [158784] (2 PDB entries)
Uniprot Q99LI7 21-549! Uniprot Q99LI7 242-549
Domain d2onda1: 2ond A:242-549 [148899]
Details for d2onda1
PDB Entry: 2ond (more details), 2.8 Å
PDB Description: crystal structure of the hat-c domain of murine cstf-77
PDB Compounds: (A:) Cleavage stimulation factor 77 kDa subunitSCOPe Domain Sequences for d2onda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}
tpqeaqqvdmwkkyiqweksnplrtedqtlitkrvmfayeqcllvlghhpdiwyeaaqyl
eqsskllaekgdmnnaklfsdeaaniyeraistllkknmllyfayadyeesrmkyekvhs
iynrllaiedidptlvyiqymkfarraegiksgrmifkkaredartrhhvyvtaalmeyy
cskdksvafkifelglkkygdipeyvlayidylshlnednntrvlfervltsgslppeks
geiwarflafesnigdlasilkvekrrftafreeyegketallvdrykfmdlypcsasel
kalgykdv
SCOPe Domain Coordinates for d2onda1:
Click to download the PDB-style file with coordinates for d2onda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2onda1:
- d2onda1 first appeared in SCOP 1.75
- d2onda1 appears in SCOPe 2.07
View in 3D
