Lineage for d2ok0l1 (2ok0 L:1-107)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered speciesSpecies Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (132 PDB entries)
Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
Domain d2ok0l1: 2ok0 L:1-107 [145722]
Other proteins in same PDB: d2ok0h_, d2ok0l2
automated match to d2ojzl1
protein/DNA complex
Details for d2ok0l1
PDB Entry: 2ok0 (more details), 1.89 Å
PDB Description: Fab ED10-DNA complex
PDB Compounds: (L:) Fab ED10 light chainSCOPe Domain Sequences for d2ok0l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ok0l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dilmtqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqsptlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshipltfgagtklevk
SCOPe Domain Coordinates for d2ok0l1:
Click to download the PDB-style file with coordinates for d2ok0l1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ok0l1:
- d2ok0l1 first appeared in SCOP 1.75
- d2ok0l1 appears in SCOPe 2.07
View in 3D
