Lineage for d2ojkb_ (2ojk B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407957Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1407958Protein automated matches [190526] (17 species)
    not a true protein
  7. 1408179Species Zoanthus sp. [TaxId:105402] [193832] (8 PDB entries)
  8. 1408191Domain d2ojkb_: 2ojk B: [194419]
    automated match to d1xssa_

Details for d2ojkb_

PDB Entry: 2ojk (more details), 2.2 Å

PDB Description: crystal structure of green fluorescent protein from zoanthus sp at 2.2 a resolution
PDB Compounds: (B:) GFP-like fluorescent chromoprotein FP506

SCOPe Domain Sequences for d2ojkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ojkb_ d.22.1.0 (B:) automated matches {Zoanthus sp. [TaxId: 105402]}
skhgltkemtmkyrmegcvdghkfvitgegigypfkgkqainlcvveggplpfaedilsa
afnygnrvfteypqdivdyfknscpagytwdrsflfedgavcicnaditvsveencmyhe
skfygvnfpadgpvmkkmtdnwepscekiipvpkqgilkgdvsmylllkdggrlrcqfdt
vykaksvprkmpdwhfiqhkltredrsdaknqkwhltehaiasgsalp

SCOPe Domain Coordinates for d2ojkb_:

Click to download the PDB-style file with coordinates for d2ojkb_.
(The format of our PDB-style files is described here.)

Timeline for d2ojkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ojka_