Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
Protein GK1870 orthologue [160182] (1 species) Predicted 4-hydroxybenzoyl-CoA thioesterase |
Species Bacillus stearothermophilus [TaxId:1422] [160183] (1 PDB entry) Uniprot Q5KYT1 1-131 |
Domain d2oiwa1: 2oiw A:1-131 [148794] complexed with edo, mg |
PDB Entry: 2oiw (more details), 2 Å
SCOPe Domain Sequences for d2oiwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oiwa1 d.38.1.1 (A:1-131) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]} mfttvitprvsetdgvghinnttvpvwfeagrheifklftpdlsfkrwrmviirmevdyv nqmyygqdvtvytgierigntsltiyeeihqngvvcakgrsvyvnfnfdtgrpepipddi rvklrehvwqp
Timeline for d2oiwa1: