Lineage for d2oi9b_ (2oi9 B:)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries) 
Domain d2oi9b_: 2oi9 B: [166701]
automated match to d1i9ea_
Details for d2oi9b_
PDB Entry: 2oi9 (more details), 2.35 Å
PDB Description: Structure of the 2C/Ld/QL9 allogeneic complex
PDB Compounds: (B:) T cell receptor alpha chainSCOPe Domain Sequences for d2oi9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oi9b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhrsdsavyfcavsgfasaltfgsgtkvivl
SCOPe Domain Coordinates for d2oi9b_:
Click to download the PDB-style file with coordinates for d2oi9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2oi9b_:
- d2oi9b_ first appeared in SCOPe 2.01
- d2oi9b_ appears in SCOPe 2.03
- d2oi9b_ appears in the current release, SCOPe 2.08
View in 3D
