Lineage for d2ohwa1 (2ohw A:3-130)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.8: YueI-like [160515] (1 family) 
automatically mapped to Pfam PF07997Family d.79.8.1: YueI-like [160516] (1 protein)
Pfam PF07997; DUF1694Protein Uncharacterized protein YueI [160517] (1 species) Species Bacillus subtilis [TaxId:1423] [160518] (1 PDB entry)
Uniprot O32092 3-130
Domain d2ohwa1: 2ohw A:3-130 [148775]
Details for d2ohwa1
PDB Entry: 2ohw (more details), 1.4 Å
PDB Description: crystal structure of the yuei protein from bacillus subtilis
PDB Compounds: (A:) YueI proteinSCOPe Domain Sequences for d2ohwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ohwa1 d.79.8.1 (A:3-130) Uncharacterized protein YueI {Bacillus subtilis [TaxId: 1423]}
edkmdlylqqgmygpletkpderhlflgslrervvlaltkgqvlrskpykeaehelknsh
nvtllingelqyqsyssyiqmasrygvpfkivsdlqfhtplgiviaadiavnreliyiqd
diynrsvl
SCOPe Domain Coordinates for d2ohwa1:
Click to download the PDB-style file with coordinates for d2ohwa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ohwa1:
- d2ohwa1 first appeared in SCOP 1.75
- d2ohwa1 appears in SCOPe 2.07
View in 3D
