Lineage for d2od0a1 (2od0 A:3-105)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
Superfamily d.198.5: YgaC/TfoX-N like [159894] (2 families) 
overall similar to the Type III secretory system chaperone subunits; different shape of the beta-sheetFamily d.198.5.2: TfoX N-terminal domain-like [159898] (1 protein)
Pfam PF04993Protein Hypothetical protein VP1028 [159899] (1 species) Species Vibrio parahaemolyticus [TaxId:670] [159900] (1 PDB entry)
Uniprot Q87QX1 3-105
Domain d2od0a1: 2od0 A:3-105 [148732]
complexed with mg, so4
Details for d2od0a1
PDB Entry: 2od0 (more details), 1.95 Å
PDB Description: The crystal structure of gene product VP1028 from Vibrio parahaemolyticus
PDB Compounds: (A:) Hypothetical protein VP1028SCOPe Domain Sequences for d2od0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2od0a1 d.198.5.2 (A:3-105) Hypothetical protein VP1028 {Vibrio parahaemolyticus [TaxId: 670]}
kpilkdsmklfealgtiksrsmfggfglfadetmfalvvnnqlhiradqqtssdfetqgl
kpyvykkrgfpvvtkyyaisselwessdrlievakkslenakl
SCOPe Domain Coordinates for d2od0a1:
Click to download the PDB-style file with coordinates for d2od0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2od0a1:
- d2od0a1 first appeared in SCOP 1.75
- d2od0a1 appears in SCOPe 2.07
View in 3D
