![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins) Pfam PF08446; PAS_2 |
![]() | Protein Bacteriophytochrome BphP [160672] (3 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [160673] (3 PDB entries) Uniprot Q9RZA4 4-130! Uniprot Q9RZA4 5-130 |
![]() | Domain d2o9ba2: 2o9b A:4-130 [148683] Other proteins in same PDB: d2o9ba1, d2o9ba3 complexed with lbv |
PDB Entry: 2o9b (more details), 2.15 Å
SCOPe Domain Sequences for d2o9ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o9ba2 d.110.3.9 (A:4-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} dplpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflg qeptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgelli lefepte
Timeline for d2o9ba2: