![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.136: Phospholipase D/nuclease [56023] (1 superfamily) beta-alpha-beta-alpha-beta-alpha-beta(4)-alpha; mixed sheet: order 1765234 |
![]() | Superfamily d.136.1: Phospholipase D/nuclease [56024] (6 families) ![]() |
![]() | Family d.136.1.4: Polyphosphate kinase C-terminal domain [143860] (1 protein) C-terminal part of Pfam PF02503; similar to PLD; contains two domains of this fold arranged as in the Nuc dimer |
![]() | Protein Polyphosphate kinase, PPK [143861] (2 species) |
![]() | Species Porphyromonas gingivalis [TaxId:837] [143862] (1 PDB entry) Uniprot Q7MTR1 318-505! Uniprot Q7MTR1 506-691 |
![]() | Domain d2o8ra4: 2o8r A:506-691 [138936] Other proteins in same PDB: d2o8ra1, d2o8ra2, d2o8rb1, d2o8rb2 complexed with so4 |
PDB Entry: 2o8r (more details), 2.7 Å
SCOPe Domain Sequences for d2o8ra4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o8ra4 d.136.1.4 (A:506-691) Polyphosphate kinase, PPK {Porphyromonas gingivalis [TaxId: 837]} rllvarynmgeaitnliereienvkrgkrgymllkmnglqdknvitqlyraseagveidl ivrgicclvpdmpqsrnirvtrlvdmylehsriwcfhnggkeevfissadwmkrnlynri etacpvldptlrreiidileiqlrdnikacridsslnniykhnsdekpvraqaaiyrylk gkeett
Timeline for d2o8ra4:
![]() Domains from other chains: (mouse over for more information) d2o8rb1, d2o8rb2, d2o8rb3, d2o8rb4 |