Lineage for d2o7ha_ (2o7h A:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1968446Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 1968447Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 1968515Protein GCN4 [57961] (2 species)
  7. 1968516Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (64 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 1968551Domain d2o7ha_: 2o7h A: [148667]
    automated match to d2o7ha1

Details for d2o7ha_

PDB Entry: 2o7h (more details), 1.86 Å

PDB Description: crystal structure of trimeric coiled coil gcn4 leucine zipper
PDB Compounds: (A:) General control protein GCN4

SCOPe Domain Sequences for d2o7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o7ha_ h.1.3.1 (A:) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
srmkqledkveellsknyhlenrvarleklvge

SCOPe Domain Coordinates for d2o7ha_:

Click to download the PDB-style file with coordinates for d2o7ha_.
(The format of our PDB-style files is described here.)

Timeline for d2o7ha_: