Lineage for d2o7ha1 (2o7h A:1-32)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1466121Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1466343Superfamily h.1.3: Leucine zipper domain [57959] (1 family) (S)
  5. 1466344Family h.1.3.1: Leucine zipper domain [57960] (16 proteins)
  6. 1466410Protein GCN4 [57961] (2 species)
  7. 1466411Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57962] (62 PDB entries)
    Uniprot P03069 249-279 ! Uniprot P03069 249-281
  8. 1466430Domain d2o7ha1: 2o7h A:1-32 [148667]
    automatically matched to d1ztaa_

Details for d2o7ha1

PDB Entry: 2o7h (more details), 1.86 Å

PDB Description: crystal structure of trimeric coiled coil gcn4 leucine zipper
PDB Compounds: (A:) General control protein GCN4

SCOPe Domain Sequences for d2o7ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o7ha1 h.1.3.1 (A:1-32) GCN4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rmkqledkveellsknyhlenrvarleklvge

SCOPe Domain Coordinates for d2o7ha1:

Click to download the PDB-style file with coordinates for d2o7ha1.
(The format of our PDB-style files is described here.)

Timeline for d2o7ha1: