Lineage for d2o6pa1 (2o6p A:30-150)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2039984Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2039985Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 2039995Protein Iron-regulated surface determinant protein C, IsdC [158913] (1 species)
  7. 2039996Species Staphylococcus aureus [TaxId:1280] [158914] (1 PDB entry)
    Uniprot Q7A654 29-150
  8. 2039997Domain d2o6pa1: 2o6p A:30-150 [148635]
    Other proteins in same PDB: d2o6pa2, d2o6pb3
    complexed with cl, hem, zn

Details for d2o6pa1

PDB Entry: 2o6p (more details), 1.5 Å

PDB Description: crystal structure of the heme-isdc complex
PDB Compounds: (A:) Iron-regulated surface determinant protein C

SCOPe Domain Sequences for d2o6pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6pa1 b.1.28.1 (A:30-150) Iron-regulated surface determinant protein C, IsdC {Staphylococcus aureus [TaxId: 1280]}
dsgtlnyevykyntndtsiandyfnkpakyikkngklyvqitvnhshwitgmsieghken
iiskntakdertsefevsklngkidgkidvyidekvngkpfkydhhynitykfngptdva
g

SCOPe Domain Coordinates for d2o6pa1:

Click to download the PDB-style file with coordinates for d2o6pa1.
(The format of our PDB-style files is described here.)

Timeline for d2o6pa1:

2039997
d2o6pa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2o6pa2