Lineage for d2o66a_ (2o66 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2951061Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187948] (3 PDB entries)
  8. 2951062Domain d2o66a_: 2o66 A: [166557]
    automated match to d1qy7a_
    complexed with flc

Details for d2o66a_

PDB Entry: 2o66 (more details), 1.9 Å

PDB Description: Crystal Structure of Arabidopsis thaliana PII bound to citrate
PDB Compounds: (A:) pii protein

SCOPe Domain Sequences for d2o66a_:

Sequence, based on SEQRES records: (download)

>d2o66a_ d.58.5.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ssdyipdskfykveaivrpwriqqvssallkigirgvtvsdvrgfgaqggsterhggsef
sedkfvakvkmeivvkkdqvesvintiiegartgeigdgkifvlpvsdvirvrtgergek
ae

Sequence, based on observed residues (ATOM records): (download)

>d2o66a_ d.58.5.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ssdyipdskfykveaivrpwriqqvssallkigirgvtvsdvrgfgedkfvakvkmeivv
kkdqvesvintiiegartgeigdgkifvlpvsdvirvrtgergekae

SCOPe Domain Coordinates for d2o66a_:

Click to download the PDB-style file with coordinates for d2o66a_.
(The format of our PDB-style files is described here.)

Timeline for d2o66a_: