![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
![]() | Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
![]() | Protein automated matches [190753] (21 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [187948] (3 PDB entries) |
![]() | Domain d2o66a_: 2o66 A: [166557] automated match to d1qy7a_ complexed with flc |
PDB Entry: 2o66 (more details), 1.9 Å
SCOPe Domain Sequences for d2o66a_:
Sequence, based on SEQRES records: (download)
>d2o66a_ d.58.5.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ssdyipdskfykveaivrpwriqqvssallkigirgvtvsdvrgfgaqggsterhggsef sedkfvakvkmeivvkkdqvesvintiiegartgeigdgkifvlpvsdvirvrtgergek ae
>d2o66a_ d.58.5.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ssdyipdskfykveaivrpwriqqvssallkigirgvtvsdvrgfgedkfvakvkmeivv kkdqvesvintiiegartgeigdgkifvlpvsdvirvrtgergekae
Timeline for d2o66a_: