Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.9: All1756-like [159230] (1 protein) cyanobacterial proteins with duplicated fatty acid binding protein-like domains; N-terminal and C-terminal domains correspond to PfamB 40396 and PfamB 60468, respectively |
Protein Uncharacterized protein All1756 ortholog [159231] (1 species) |
Species Nostoc punctiforme [TaxId:272131] [159232] (1 PDB entry) |
Domain d2o62a2: 2o62 A:1-132 [148623] complexed with cl, gol |
PDB Entry: 2o62 (more details), 1.75 Å
SCOPe Domain Sequences for d2o62a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o62a2 b.60.1.9 (A:1-132) Uncharacterized protein All1756 ortholog {Nostoc punctiforme [TaxId: 272131]} mksqwecflqnlgvwegsfsnfspegtllndtssrlcleglnnnqtvrltlsrsgkddvi refrsvgggllffengsfsegliqlgpfsefggelafvhenrrlrlvqlfdrnghlnglt lirehlagtpva
Timeline for d2o62a2: