![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.13: NE1354 [140532] (2 proteins) contains extra C-terminal dimerisation arm (beta-strand) automatically mapped to Pfam PF13744 |
![]() | Protein Hypothetical protein RPA3824 [158469] (1 species) |
![]() | Species Rhodopseudomonas palustris [TaxId:1076] [158470] (1 PDB entry) Uniprot Q6N370 28-116 |
![]() | Domain d2o38a1: 2o38 A:28-116 [148568] complexed with acy |
PDB Entry: 2o38 (more details), 1.83 Å
SCOPe Domain Sequences for d2o38a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]} pdaeerqtklrlayalnavidrarlsqaaaaarlginqpkvsalrnyklegfsverlmtl lnaldqdveivirkkprsraaarisvvaa
Timeline for d2o38a1: