Lineage for d2o38a1 (2o38 A:28-116)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709757Family a.35.1.13: NE1354 [140532] (2 proteins)
    contains extra C-terminal dimerisation arm (beta-strand)
    automatically mapped to Pfam PF13744
  6. 2709762Protein Hypothetical protein RPA3824 [158469] (1 species)
  7. 2709763Species Rhodopseudomonas palustris [TaxId:1076] [158470] (1 PDB entry)
    Uniprot Q6N370 28-116
  8. 2709764Domain d2o38a1: 2o38 A:28-116 [148568]
    complexed with acy

Details for d2o38a1

PDB Entry: 2o38 (more details), 1.83 Å

PDB Description: putative xre family transcriptional regulator
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2o38a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o38a1 a.35.1.13 (A:28-116) Hypothetical protein RPA3824 {Rhodopseudomonas palustris [TaxId: 1076]}
pdaeerqtklrlayalnavidrarlsqaaaaarlginqpkvsalrnyklegfsverlmtl
lnaldqdveivirkkprsraaarisvvaa

SCOPe Domain Coordinates for d2o38a1:

Click to download the PDB-style file with coordinates for d2o38a1.
(The format of our PDB-style files is described here.)

Timeline for d2o38a1: