Lineage for d2o34a1 (2o34 A:2-248)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.96: T-fold [55619] (2 superfamilies)
beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
tunnel-shaped: its known members form wide oligomeric barrels different sizes
Superfamily d.96.2: ApbE-like [143631] (2 families) 
duplication: contains two differently decorated beta(2)-alpha(2)-beta(2) subdomains, similar to other T-fold domains; probably does not form the tunnel-shaped oligomers
Family d.96.2.2: DVU1097-like [160566] (2 proteins)
Pfam PF04040; DUF375Protein Hypothetical protein DVU1097 [160567] (1 species) Species Desulfovibrio vulgaris [TaxId:881] [160568] (1 PDB entry)
Uniprot Q72D34 1-248
Domain d2o34a1: 2o34 A:2-248 [148565]
Other proteins in same PDB: d2o34a2, d2o34b_
complexed with na
Details for d2o34a1
PDB Entry: 2o34 (more details), 1.95 Å
PDB Description: crystal structure of protein dvu1097 from desulfovibrio vulgaris hildenborough, pfam duf375
PDB Compounds: (A:) hypothetical proteinSCOPe Domain Sequences for d2o34a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o34a1 d.96.2.2 (A:2-248) Hypothetical protein DVU1097 {Desulfovibrio vulgaris [TaxId: 881]}
pmqhvhtspvrdyrnrcarregetvfqvvveetdlrvtalaelatpmaayvgelraqlkv
wmefqpafrhslvpvevpegapevvrrmahgarlvgvgpfaavagtiaqmvaerfvdvsp
elivenggdlylyserdrvvgilpdpasgdmvgilvragtapvslcgssarighslslgd
gdlavvrardasladaaatafgnmlrraddvaavteraaqlasigiegvyaqcggrigiw
gdmelav
SCOPe Domain Coordinates for d2o34a1:
Click to download the PDB-style file with coordinates for d2o34a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o34a1:
- d2o34a1 first appeared in SCOP 1.75
- d2o34a1 appears in SCOPe 2.07
View in 3D
